Lineage for d1w0kd1 (1w0k D:358-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643803Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 643804Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 643805Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 643851Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 643854Species Cow (Bos taurus) [TaxId:9913] [88929] (12 PDB entries)
  8. 643861Domain d1w0kd1: 1w0k D:358-474 [109017]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd2, d1w0kd3, d1w0ke2, d1w0ke3, d1w0kf2, d1w0kf3, d1w0kg_

Details for d1w0kd1

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase
PDB Compounds: (D:) ATP synthase beta chain, mitochondrial precursor

SCOP Domain Sequences for d1w0kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0kd1 a.69.1.1 (D:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1w0kd1:

Click to download the PDB-style file with coordinates for d1w0kd1.
(The format of our PDB-style files is described here.)

Timeline for d1w0kd1: