SCOP 1.71: Domain d1w0kc2: 1w0k C:24-94

Lineage for d1w0kc2 (1w0k C:24-94)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (12 PDB entries)

8. Domain d1w0kc2: 1w0k C:24-94 [109015]
   Other proteins in same PDB: d1w0ka1, d1w0ka3, d1w0kb1, d1w0kb3, d1w0kc1, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3, d1w0kg_
   complexed with adp, gol, mg, po4

Details for d1w0kc2

PDB Entry: 1w0k, 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0kc2:

Sequence; same for both SEQRES and ATOM records:

>d1w0kc2 b.49.1.1 (C:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1w0kc2:

• d1w0kc2 first appeared in SCOP 1.69
  
• d1w0kc2 appears in SCOP 1.73
  
• d1w0kc2 appears in the current release, SCOPe 2.08