Lineage for d1w0kb2 (1w0k B:24-94)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562760Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 562761Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 562762Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 562763Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 562766Species Cow (Bos taurus) [TaxId:9913] [88673] (12 PDB entries)
  8. 562774Domain d1w0kb2: 1w0k B:24-94 [109012]
    Other proteins in same PDB: d1w0ka1, d1w0ka3, d1w0kb1, d1w0kb3, d1w0kc1, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3, d1w0kg_

Details for d1w0kb2

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0kb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1w0kb2:

Click to download the PDB-style file with coordinates for d1w0kb2.
(The format of our PDB-style files is described here.)

Timeline for d1w0kb2: