Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
Domain d1w0ka2: 1w0k A:24-94 [109009] Other proteins in same PDB: d1w0ka1, d1w0ka3, d1w0kb1, d1w0kb3, d1w0kc1, d1w0kc3, d1w0kd1, d1w0kd2, d1w0kd3, d1w0ke1, d1w0ke2, d1w0ke3, d1w0kf1, d1w0kf2, d1w0kf3, d1w0kg_ complexed with adp, gol, mg, po4 |
PDB Entry: 1w0k (more details), 2.85 Å
SCOPe Domain Sequences for d1w0ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0ka2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d1w0ka2: