Lineage for d1w0jf3 (1w0j F:82-357)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 582685Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (15 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 582783Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 582786Species Cow (Bos taurus) [TaxId:9913] [88780] (12 PDB entries)
  8. 582789Domain d1w0jf3: 1w0j F:82-357 [109006]
    Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd2, d1w0je1, d1w0je2, d1w0jf1, d1w0jf2, d1w0jg_
    complexed with adp, bef, gol, mo3, mo4, po4

Details for d1w0jf3

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0jf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0jf3 c.37.1.11 (F:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1w0jf3:

Click to download the PDB-style file with coordinates for d1w0jf3.
(The format of our PDB-style files is described here.)

Timeline for d1w0jf3: