Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries) Uniprot P00829 |
Domain d1w0jf3: 1w0j F:82-357 [109006] Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd2, d1w0je1, d1w0je2, d1w0jf1, d1w0jf2, d1w0jg_ complexed with adp, bef, gol, mg, po4 |
PDB Entry: 1w0j (more details), 2.2 Å
SCOPe Domain Sequences for d1w0jf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0jf3 c.37.1.11 (F:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1w0jf3: