SCOP 1.69: Domain d1w0je2: 1w0j E:9-81

Lineage for d1w0je2 (1w0j E:9-81)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)

8. Domain d1w0je2: 1w0j E:9-81 [109002]
   Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd3, d1w0je1, d1w0je3, d1w0jf1, d1w0jf3, d1w0jg_

Details for d1w0je2

PDB Entry: 1w0j, 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0je2:

Sequence; same for both SEQRES and ATOM records:

>d1w0je2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1w0je2:

• d1w0je2 is new in SCOP 1.69
  
• d1w0je2 appears in SCOP 1.71
  
• d1w0je2 appears in the current release, SCOPe 2.08