Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
Domain d1w0jc2: 1w0j C:24-94 [108996] Other proteins in same PDB: d1w0ja1, d1w0ja3, d1w0jb1, d1w0jb3, d1w0jc1, d1w0jc3, d1w0jd1, d1w0jd2, d1w0jd3, d1w0je1, d1w0je2, d1w0je3, d1w0jf1, d1w0jf2, d1w0jf3, d1w0jg_ complexed with adp, bef, gol, mg, po4 |
PDB Entry: 1w0j (more details), 2.2 Å
SCOPe Domain Sequences for d1w0jc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0jc2 b.49.1.1 (C:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d1w0jc2: