![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) ![]() |
![]() | Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
![]() | Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88893] (12 PDB entries) |
![]() | Domain d1w0jc1: 1w0j C:380-510 [108995] Other proteins in same PDB: d1w0ja2, d1w0ja3, d1w0jb2, d1w0jb3, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd2, d1w0jd3, d1w0je1, d1w0je2, d1w0je3, d1w0jf1, d1w0jf2, d1w0jf3, d1w0jg_ |
PDB Entry: 1w0j (more details), 2.2 Å
SCOP Domain Sequences for d1w0jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0jc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1w0jc1: