Lineage for d1w0jc1 (1w0j C:380-510)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445008Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 445009Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 445010Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 445011Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 445014Species Cow (Bos taurus) [TaxId:9913] [88893] (12 PDB entries)
  8. 445017Domain d1w0jc1: 1w0j C:380-510 [108995]
    Other proteins in same PDB: d1w0ja2, d1w0ja3, d1w0jb2, d1w0jb3, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd2, d1w0jd3, d1w0je1, d1w0je2, d1w0je3, d1w0jf1, d1w0jf2, d1w0jf3, d1w0jg_

Details for d1w0jc1

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase

SCOP Domain Sequences for d1w0jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0jc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1w0jc1:

Click to download the PDB-style file with coordinates for d1w0jc1.
(The format of our PDB-style files is described here.)

Timeline for d1w0jc1: