Lineage for d1w0ja2 (1w0j A:24-94)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408139Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2408140Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2408159Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 2408166Domain d1w0ja2: 1w0j A:24-94 [108990]
    Other proteins in same PDB: d1w0ja1, d1w0ja3, d1w0jb1, d1w0jb3, d1w0jc1, d1w0jc3, d1w0jd1, d1w0jd2, d1w0jd3, d1w0je1, d1w0je2, d1w0je3, d1w0jf1, d1w0jf2, d1w0jf3, d1w0jg_
    complexed with adp, bef, gol, mg, po4

Details for d1w0ja2

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain heart isoform, mitochondrial precursor

SCOPe Domain Sequences for d1w0ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ja2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d1w0ja2:

Click to download the PDB-style file with coordinates for d1w0ja2.
(The format of our PDB-style files is described here.)

Timeline for d1w0ja2: