Lineage for d1w0ja1 (1w0j A:380-510)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771914Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 771915Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 771916Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 771917Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 771920Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries)
    Uniprot P19483
  8. 771927Domain d1w0ja1: 1w0j A:380-510 [108989]
    Other proteins in same PDB: d1w0ja2, d1w0ja3, d1w0jb2, d1w0jb3, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd2, d1w0jd3, d1w0je1, d1w0je2, d1w0je3, d1w0jf1, d1w0jf2, d1w0jf3, d1w0jg_

Details for d1w0ja1

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain heart isoform, mitochondrial precursor

SCOP Domain Sequences for d1w0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ja1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1w0ja1:

Click to download the PDB-style file with coordinates for d1w0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1w0ja1: