Lineage for d1w0ga_ (1w0g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005397Protein Mammalian cytochrome P450 3a4 [109958] (1 species)
  7. 2005398Species Human (Homo sapiens) [TaxId:9606] [109959] (7 PDB entries)
    Uniprot P08684
  8. 2005411Domain d1w0ga_: 1w0g A: [108988]
    complexed with hem, myt

Details for d1w0ga_

PDB Entry: 1w0g (more details), 2.74 Å

PDB Description: crystal structure of human cytochrome p450 3a4
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d1w0ga_:

Sequence, based on SEQRES records: (download)

>d1w0ga_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}
ygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlai
tdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklke
mvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfv
entkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledt
qkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelath
pdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdvein
gmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncig
mrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdg

Sequence, based on observed residues (ATOM records): (download)

>d1w0ga_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}
ygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlai
tdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklke
mvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfv
entkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledf
lqlmialsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnka
pptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhr
dpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnf
sfkpcketqiplklslggllqpekpvvlkvesrdg

SCOPe Domain Coordinates for d1w0ga_:

Click to download the PDB-style file with coordinates for d1w0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1w0ga_: