Lineage for d1w0ba_ (1w0b A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439641Fold a.7: Spectrin repeat-like [46965] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 439796Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) (S)
    the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, scop_sf 55194
  5. 439797Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
    this is a repeat family; one repeat unit is 1w0a A: found in domain
  6. 439798Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)
  7. 439799Species Human (Homo sapiens) [TaxId:9606] [109754] (3 PDB entries)
  8. 439802Domain d1w0ba_: 1w0b A: [108985]

Details for d1w0ba_

PDB Entry: 1w0b (more details)

PDB Description: solution structure of the human alpha-hemoglobin stabilizing protein (ahsp) p30a mutant

SCOP Domain Sequences for d1w0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ba_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens)}
sallkankdlisaglkefsvllnqqvfndalvseedmvtvvedwmnfyinyyrqqvtgep
qerdkalqelrqelntlanpflakyrdflkshelpshpppss

SCOP Domain Coordinates for d1w0ba_:

Click to download the PDB-style file with coordinates for d1w0ba_.
(The format of our PDB-style files is described here.)

Timeline for d1w0ba_: