Lineage for d1w02a_ (1w02 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505452Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2505453Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2505526Species Pseudomonas putida [TaxId:303] [54437] (46 PDB entries)
    Uniprot P07445
  8. 2505624Domain d1w02a_: 1w02 A: [108981]
    mutant

Details for d1w02a_

PDB Entry: 1w02 (more details), 2.3 Å

PDB Description: Crystal structure of mutant enzyme Y16F/D103L of ketosteroid isomerase from Pseudomonas putida biotype B
PDB Compounds: (A:) steroid delta-isomerase

SCOPe Domain Sequences for d1w02a_:

Sequence, based on SEQRES records: (download)

>d1w02a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarfielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayws
evnlsvr

Sequence, based on observed residues (ATOM records): (download)

>d1w02a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarfielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvpcaldvilvmrfdehgriqtmqaywsevnlsvr

SCOPe Domain Coordinates for d1w02a_:

Click to download the PDB-style file with coordinates for d1w02a_.
(The format of our PDB-style files is described here.)

Timeline for d1w02a_: