SCOP 1.69: Domain d1w01b_: 1w01 B:

Lineage for d1w01b_ (1w01 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (12 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (17 PDB entries)

8. Domain d1w01b_: 1w01 B: [108980]

Details for d1w01b_

PDB Entry: 1w01, 2.2 Å

PDB Description: Crystal structure of mutant enzymes Y57F/D103L of ketosteroid isomerase from Pseudomonas putida biotype B

SCOP Domain Sequences for d1w01b_:

Sequence; same for both SEQRES and ATOM records:

>d1w01b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaaffrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayws
evnlsvr

Timeline for d1w01b_:

• d1w01b_ is new in SCOP 1.69
  
• d1w01b_ appears in SCOP 1.71
  
• d1w01b_ appears in the current release, SCOPe 2.08