Lineage for d1w01b_ (1w01 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500831Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 500911Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 500912Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 500930Species Pseudomonas putida [TaxId:303] [54437] (17 PDB entries)
  8. 500948Domain d1w01b_: 1w01 B: [108980]

Details for d1w01b_

PDB Entry: 1w01 (more details), 2.2 Å

PDB Description: Crystal structure of mutant enzymes Y57F/D103L of ketosteroid isomerase from Pseudomonas putida biotype B

SCOP Domain Sequences for d1w01b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w01b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaaffrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayws
evnlsvr

SCOP Domain Coordinates for d1w01b_:

Click to download the PDB-style file with coordinates for d1w01b_.
(The format of our PDB-style files is described here.)

Timeline for d1w01b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w01a_