Lineage for d1vzzb_ (1vzz B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599942Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 600024Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 600025Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 600043Species Pseudomonas putida [TaxId:303] [54437] (17 PDB entries)
  8. 600063Domain d1vzzb_: 1vzz B: [108978]
    mutant

Details for d1vzzb_

PDB Entry: 1vzz (more details), 2.3 Å

PDB Description: crystal structure of mutant enzyme y32f/d103l of ketosteroid isomerase from pseudomonas putida biotype b

SCOP Domain Sequences for d1vzzb_:

Sequence, based on SEQRES records: (download)

>d1vzzb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d1vzzb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmfaddatvedpfgqppihgreqiaafyrqgl
gkvracltgpvrashngcgampfrvemvwngqpcaldvilvmrfdehgriqtmqaywsev
nlsv

SCOP Domain Coordinates for d1vzzb_:

Click to download the PDB-style file with coordinates for d1vzzb_.
(The format of our PDB-style files is described here.)

Timeline for d1vzzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vzza_