![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) ![]() |
![]() | Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins) |
![]() | Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [64133] (13 PDB entries) |
![]() | Domain d1vzxb_: 1vzx B: [108976] |
PDB Entry: 1vzx (more details), 1.97 Å
SCOP Domain Sequences for d1vzxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzxb_ c.68.1.9 (B:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus)} klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqyhdeshln kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
Timeline for d1vzxb_: