Lineage for d1vzua_ (1vzu A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491356Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 491357Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 491547Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)
  6. 491548Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 491549Species Cow (Bos taurus) [TaxId:9913] [64133] (13 PDB entries)
  8. 491558Domain d1vzua_: 1vzu A: [108973]

Details for d1vzua_

PDB Entry: 1vzu (more details), 1.97 Å

PDB Description: roles of active site tryptophans in substrate binding and catalysis by alpha-1,3 galactosyltransferase

SCOP Domain Sequences for d1vzua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzua_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus)}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqyhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

SCOP Domain Coordinates for d1vzua_:

Click to download the PDB-style file with coordinates for d1vzua_.
(The format of our PDB-style files is described here.)

Timeline for d1vzua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vzub_