SCOPe 2.07: Domain d1vzsa_: 1vzs A:

Lineage for d1vzsa_ (1vzs A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.45: Mitochondrial ATP synthase coupling factor 6 [111356] (1 superfamily)
   2 helices, hairpin

4. Superfamily f.45.1: Mitochondrial ATP synthase coupling factor 6 [111357] (1 family)
   automatically mapped to Pfam PF05511

5. Family f.45.1.1: Mitochondrial ATP synthase coupling factor 6 [111358] (1 protein)
   Pfam PF05511

6. Protein ATPase subunit F6 [111359] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [111360] (2 PDB entries)
   Uniprot P02721 33-108

8. Domain d1vzsa_: 1vzs A: [108972]

Details for d1vzsa_

PDB Entry: 1vzs

PDB Description: solution structure of subunit f6 from the peripheral stalk region of atp synthase from bovine heart mitochondria

PDB Compounds: (A:) ATP synthase coupling factor 6, mitochondrial precursor

SCOPe Domain Sequences for d1vzsa_:

Sequence; same for both SEQRES and ATOM records:

>d1vzsa_ f.45.1.1 (A:) ATPase subunit F6 {Cow (Bos taurus) [TaxId: 9913]}
nkeldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpn
ftfedpkfevvekpqs

Timeline for d1vzsa_:

• d1vzsa_ first appeared in SCOP 1.69
  
• d1vzsa_ appears in SCOPe 2.06
  
• d1vzsa_ appears in the current release, SCOPe 2.08