Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.45: Mitochondrial ATP synthase coupling factor 6 [111356] (1 superfamily) 2 helices, hairpin |
Superfamily f.45.1: Mitochondrial ATP synthase coupling factor 6 [111357] (1 family) automatically mapped to Pfam PF05511 |
Family f.45.1.1: Mitochondrial ATP synthase coupling factor 6 [111358] (1 protein) Pfam PF05511 |
Protein ATPase subunit F6 [111359] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [111360] (2 PDB entries) Uniprot P02721 33-108 |
Domain d1vzsa_: 1vzs A: [108972] |
PDB Entry: 1vzs (more details)
SCOPe Domain Sequences for d1vzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzsa_ f.45.1.1 (A:) ATPase subunit F6 {Cow (Bos taurus) [TaxId: 9913]} nkeldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpn ftfedpkfevvekpqs
Timeline for d1vzsa_: