![]() | Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
![]() | Fold f.45: Mitochondrial ATP synthase coupling factor 6 [111356] (1 superfamily) 2 helices, hairpin |
![]() | Superfamily f.45.1: Mitochondrial ATP synthase coupling factor 6 [111357] (1 family) ![]() |
![]() | Family f.45.1.1: Mitochondrial ATP synthase coupling factor 6 [111358] (1 protein) Pfam 05511 |
![]() | Protein ATPase subunit F6 [111359] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [111360] (1 PDB entry) |
![]() | Domain d1vzsa_: 1vzs A: [108972] |
PDB Entry: 1vzs (more details)
SCOP Domain Sequences for d1vzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzsa_ f.45.1.1 (A:) ATPase subunit F6 {Cow (Bos taurus)} nkeldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpn ftfedpkfevvekpqs
Timeline for d1vzsa_: