Lineage for d1vzsa_ (1vzs A:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 621117Fold f.45: Mitochondrial ATP synthase coupling factor 6 [111356] (1 superfamily)
    2 helices, hairpin
  4. 621118Superfamily f.45.1: Mitochondrial ATP synthase coupling factor 6 [111357] (1 family) (S)
  5. 621119Family f.45.1.1: Mitochondrial ATP synthase coupling factor 6 [111358] (1 protein)
    Pfam 05511
  6. 621120Protein ATPase subunit F6 [111359] (1 species)
  7. 621121Species Cow (Bos taurus) [TaxId:9913] [111360] (1 PDB entry)
  8. 621122Domain d1vzsa_: 1vzs A: [108972]

Details for d1vzsa_

PDB Entry: 1vzs (more details)

PDB Description: solution structure of subunit f6 from the peripheral stalk region of atp synthase from bovine heart mitochondria

SCOP Domain Sequences for d1vzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzsa_ f.45.1.1 (A:) ATPase subunit F6 {Cow (Bos taurus)}
nkeldpvqklfvdkireyrtkrqtsggpvdagpeyqqdldrelfklkqmygkadmntfpn
ftfedpkfevvekpqs

SCOP Domain Coordinates for d1vzsa_:

Click to download the PDB-style file with coordinates for d1vzsa_.
(The format of our PDB-style files is described here.)

Timeline for d1vzsa_: