![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Ribosomal protein S6 kinase alpha 5, Msk1 [111192] (1 species) AGC group (?); S6 kinase subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111193] (1 PDB entry) Uniprot O75582 24-345 |
![]() | Domain d1vzoa_: 1vzo A: [108971] complexed with bme, so4 |
PDB Entry: 1vzo (more details), 1.8 Å
SCOPe Domain Sequences for d1vzoa_:
Sequence, based on SEQRES records: (download)
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} qlltvkhelrtanltghaekvgienfellkvlgtgaygkvflvrkisghdtgklyamkvl kkativqkakttehtrterqvlehirqspflvtlhyafqtetklhlildyinggelfthl sqrerftehevqiyvgeivlalehlhklgiiyrdiklenilldsnghvvltdfglskefv adeteraydfcgtieymapdivrggdsghdkavdwwslgvlmyelltgaspftvdgekns qaeisrrilkseppypqemsalakdliqrllmkdpkkrlgcgprdadeikehlffqkinw ddlaakkvpapfkpvirdeldv
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} qlltvkhelrtanltghaekvgienfellkvlgtgaygkvflvrkisghdtgklyamkvl kkativqkakttehtrterqvlehirqspflvtlhyafqtetklhlildyinggelfthl sqrerftehevqiyvgeivlalehlhklgiiyrdiklenilldsnghvvltdfglskefv adeteraydfcgtieymapdivrggddkavdwwslgvlmyelltgaspftvdgeknsqae isrrilkseppypqemsalakdliqrllmkdpkkrlgcgprdadeikehlffqkinwddl aakkvpapfkpvirdeldv
Timeline for d1vzoa_: