| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) ![]() |
| Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
| Protein Desulfoferrodoxin C-terminal domain [49371] (2 species) |
| Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (3 PDB entries) Uniprot Q46495 |
| Domain d1vzib1: 1vzi B:38-125 [108969] Other proteins in same PDB: d1vzia2, d1vzib2 complexed with ca, cl, fe2 |
PDB Entry: 1vzi (more details), 1.15 Å
SCOPe Domain Sequences for d1vzib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzib1 b.1.13.1 (B:38-125) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
entvdaakakhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvareycnihghwkaen
Timeline for d1vzib1: