Lineage for d1vzia2 (1vzi A:1-37)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524222Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 524295Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 524296Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)
  7. 524297Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (3 PDB entries)
  8. 524298Domain d1vzia2: 1vzi A:1-37 [108968]
    Other proteins in same PDB: d1vzia1, d1vzib1

Details for d1vzia2

PDB Entry: 1vzi (more details), 1.15 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction

SCOP Domain Sequences for d1vzia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzia2 g.41.5.2 (A:1-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii)}
perlqvykcevcgnivevlnggigelvccnqdmklms

SCOP Domain Coordinates for d1vzia2:

Click to download the PDB-style file with coordinates for d1vzia2.
(The format of our PDB-style files is described here.)

Timeline for d1vzia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzia1