SCOPe 2.07: Domain d1vzia1: 1vzi A:38-125

Lineage for d1vzia1 (1vzi A:38-125)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (3 PDB entries)
   Uniprot Q46495

8. Domain d1vzia1: 1vzi A:38-125 [108967]
   Other proteins in same PDB: d1vzia2, d1vzib2
   complexed with ca, cl, fe2

Details for d1vzia1

PDB Entry: 1vzi, 1.15 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction

PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d1vzia1:

Sequence; same for both SEQRES and ATOM records:

>d1vzia1 b.1.13.1 (A:38-125) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
entvdaakakhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvareycnihghwkaen

Timeline for d1vzia1:

• d1vzia1 first appeared in SCOP 1.69
  
• d1vzia1 appears in SCOPe 2.06
  
• d1vzia1 appears in the current release, SCOPe 2.08