Class g: Small proteins [56992] (92 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) |
Family g.41.5.2: Desulforedoxin [57813] (2 proteins) automatically mapped to Pfam PF06397 |
Protein Desulfoferrodoxin N-terminal domain [57816] (2 species) |
Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (3 PDB entries) Uniprot Q46495 |
Domain d1vzhb2: 1vzh B:2-37 [108966] Other proteins in same PDB: d1vzha1, d1vzhb1 complexed with ca, fc6, fe |
PDB Entry: 1vzh (more details), 1.69 Å
SCOPe Domain Sequences for d1vzhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzhb2 g.41.5.2 (B:2-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} perlqvykcevcgnivevlnggigelvccnqdmklm
Timeline for d1vzhb2: