Lineage for d1vzhb2 (1vzh B:2-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036654Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
    automatically mapped to Pfam PF06397
  6. 3036655Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)
  7. 3036656Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (3 PDB entries)
    Uniprot Q46495
  8. 3036662Domain d1vzhb2: 1vzh B:2-37 [108966]
    Other proteins in same PDB: d1vzha1, d1vzhb1
    complexed with ca, fc6, fe

Details for d1vzhb2

PDB Entry: 1vzh (more details), 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction
PDB Compounds: (B:) desulfoferrodoxin

SCOPe Domain Sequences for d1vzhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzhb2 g.41.5.2 (B:2-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

SCOPe Domain Coordinates for d1vzhb2:

Click to download the PDB-style file with coordinates for d1vzhb2.
(The format of our PDB-style files is described here.)

Timeline for d1vzhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzhb1