Lineage for d1vzha1 (1vzh A:38-126)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523580Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1523581Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
    automatically mapped to Pfam PF01880
  6. 1523582Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)
  7. 1523583Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (3 PDB entries)
    Uniprot Q46495
  8. 1523588Domain d1vzha1: 1vzh A:38-126 [108963]
    Other proteins in same PDB: d1vzha2, d1vzhb2
    complexed with ca, fc6, fe

Details for d1vzha1

PDB Entry: 1vzh (more details), 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction
PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d1vzha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzha1 b.1.13.1 (A:38-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
sentvdaakakhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvareycnihghwkaen

SCOPe Domain Coordinates for d1vzha1:

Click to download the PDB-style file with coordinates for d1vzha1.
(The format of our PDB-style files is described here.)

Timeline for d1vzha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzha2