SCOPe 2.06: Domain d1vzgb2: 1vzg B:2-37

Lineage for d1vzgb2 (1vzg B:2-37)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
   automatically mapped to Pfam PF06397

6. Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (3 PDB entries)
   Uniprot Q46495

8. Domain d1vzgb2: 1vzg B:2-37 [108962]
   Other proteins in same PDB: d1vzga1, d1vzgb1
   complexed with ca, fc6, fe

Details for d1vzgb2

PDB Entry: 1vzg, 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction

PDB Compounds: (B:) desulfoferrodoxin

SCOPe Domain Sequences for d1vzgb2:

Sequence; same for both SEQRES and ATOM records:

>d1vzgb2 g.41.5.2 (B:2-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

Timeline for d1vzgb2:

• d1vzgb2 first appeared in SCOP 1.69
  
• d1vzgb2 appears in SCOPe 2.05
  
• d1vzgb2 appears in SCOPe 2.07
  
• d1vzgb2 appears in the current release, SCOPe 2.08