Lineage for d1vzgb1 (1vzg B:38-126)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111453Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1111454Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
  6. 1111455Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)
  7. 1111456Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (6 PDB entries)
    Uniprot Q46495
  8. 1111464Domain d1vzgb1: 1vzg B:38-126 [108961]
    Other proteins in same PDB: d1vzga2, d1vzgb2
    complexed with ca, fc6, fe

Details for d1vzgb1

PDB Entry: 1vzg (more details), 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction
PDB Compounds: (B:) desulfoferrodoxin

SCOPe Domain Sequences for d1vzgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzgb1 b.1.13.1 (B:38-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
sentvdaakakhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvareycnihghwkaen

SCOPe Domain Coordinates for d1vzgb1:

Click to download the PDB-style file with coordinates for d1vzgb1.
(The format of our PDB-style files is described here.)

Timeline for d1vzgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzgb2