Lineage for d1vzga2 (1vzg A:2-37)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750946Family g.41.5.2: Desulforedoxin [57813] (2 proteins)
  6. 750947Protein Desulfoferrodoxin N-terminal domain [57816] (2 species)
  7. 750948Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [111452] (3 PDB entries)
  8. 750951Domain d1vzga2: 1vzg A:2-37 [108960]
    Other proteins in same PDB: d1vzga1, d1vzgb1

Details for d1vzga2

PDB Entry: 1vzg (more details), 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction
PDB Compounds: (A:) desulfoferrodoxin

SCOP Domain Sequences for d1vzga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzga2 g.41.5.2 (A:2-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

SCOP Domain Coordinates for d1vzga2:

Click to download the PDB-style file with coordinates for d1vzga2.
(The format of our PDB-style files is described here.)

Timeline for d1vzga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzga1