Lineage for d1vzga1 (1vzg A:38-126)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 456035Superfamily b.1.13: Superoxide reductase-like [49367] (1 family) (S)
  5. 456036Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
    binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
  6. 456037Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)
  7. 456038Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (3 PDB entries)
  8. 456041Domain d1vzga1: 1vzg A:38-126 [108959]
    Other proteins in same PDB: d1vzga2, d1vzgb2

Details for d1vzga1

PDB Entry: 1vzg (more details), 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction

SCOP Domain Sequences for d1vzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzga1 b.1.13.1 (A:38-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii)}
sentvdaakakhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvareycnihghwkaen

SCOP Domain Coordinates for d1vzga1:

Click to download the PDB-style file with coordinates for d1vzga1.
(The format of our PDB-style files is described here.)

Timeline for d1vzga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vzga2