SCOP 1.69: Domain d1vzga1: 1vzg A:38-126

Lineage for d1vzga1 (1vzg A:38-126)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (1 family)

5. Family b.1.13.1: Superoxide reductase-like [49368] (2 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins

6. Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (3 PDB entries)

8. Domain d1vzga1: 1vzg A:38-126 [108959]
   Other proteins in same PDB: d1vzga2, d1vzgb2

Details for d1vzga1

PDB Entry: 1vzg, 1.69 Å

PDB Description: structure of superoxide reductase bound to ferrocyanide and active site expansion upon x-ray induced photoreduction

SCOP Domain Sequences for d1vzga1:

Sequence; same for both SEQRES and ATOM records:

>d1vzga1 b.1.13.1 (A:38-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii)}
sentvdaakakhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvareycnihghwkaen

Timeline for d1vzga1:

• d1vzga1 is new in SCOP 1.69
  
• d1vzga1 appears in SCOP 1.71
  
• d1vzga1 appears in the current release, SCOPe 2.08