Lineage for d1vz7d_ (1vz7 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996529Fold d.154: DmpA/ArgJ-like [56265] (1 superfamily)
    duplication of beta(3)-alpha-beta-alpha motif; 4 layers: alpha/beta/beta/alpha
  4. 2996530Superfamily d.154.1: DmpA/ArgJ-like [56266] (3 families) (S)
    convergent similarity to the Ntn amidohydrolases
  5. 2996540Family d.154.1.2: ArgJ-like [111219] (1 protein)
    Pfam PF01960; contains extra C-terminal alpha+beta domain [beta-alpha(2)-beta(2)-alpha-beta(2); 2 layers, a/b; mixed beta-sheet, order: 51423, strands 1 and 4 are parallel to each other]
  6. 2996541Protein Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) [111220] (1 species)
  7. 2996542Species Streptomyces clavuligerus [TaxId:1901] [111221] (3 PDB entries)
    Uniprot Q53940
    d1: 8-260; d2: 261-390
  8. 2996552Domain d1vz7d_: 1vz7 D: [108954]
    complexed with so4

Details for d1vz7d_

PDB Entry: 1vz7 (more details), 3 Å

PDB Description: ornithine acetyltransferase (orf6 gene product - clavulanic acid biosynthesis) from streptomyces clavuligerus
PDB Compounds: (D:) ornithine acetyl-transferase

SCOPe Domain Sequences for d1vz7d_:

Sequence, based on SEQRES records: (download)

>d1vz7d_ d.154.1.2 (D:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]}
tprgfvvhtapvgladdgrddftvlastapatvsavftrsrfagpsvvlcreavadgqar
gvvvlarnanvatglegeenarevreavaralglpegemliastgvigrqypmesirehl
ktlewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdmatlltffa
tdarldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagefeealhta
alalvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcdpnwgrva
maigkcsddtdidqervtirfgevevyppkargdqaddalraavaehlrgdevvigidla
iadgaftvygcdltegyvrlnse

Sequence, based on observed residues (ATOM records): (download)

>d1vz7d_ d.154.1.2 (D:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]}
tprgfvvhtapvgladdgrddftvlaspatvsavftrsrfagpsvvlcreavadgqargv
vvlarnanvatglegeenarevreavaralglpegemliastgvigrqypmesirehlkt
lewpageggfdraaraimttdtrpkevrvsvggatlvgiakgvgmlepdmatlltffatd
arldpaeqdrlfrrvmdrtfnavsidtdtstsdtavlfanglagevdagefeealhtaal
alvkdiasdgegaaklievqvtgarddaqakrvgktvvnsplvktavhgcdpnwgrvama
igkcsddtdidqervtirfgevevyppddalraavaehlrgdevvigidlaiadgaftvy
gcdltegyvrlnse

SCOPe Domain Coordinates for d1vz7d_:

Click to download the PDB-style file with coordinates for d1vz7d_.
(The format of our PDB-style files is described here.)

Timeline for d1vz7d_: