Lineage for d1vz3a1 (1vz3 A:1-430)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) 
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein) Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries) 
Domain d1vz3a1: 1vz3 A:1-430 [108947]
Other proteins in same PDB: d1vz3a2
complexed with gol; mutant
Details for d1vz3a1
PDB Entry: 1vz3 (more details), 1.6 Å
PDB Description: prolyl oligopeptidase from porcine brain, t597c mutant
SCOP Domain Sequences for d1vz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vz3a1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi
SCOP Domain Coordinates for d1vz3a1:
Click to download the PDB-style file with coordinates for d1vz3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vz3a1:
- d1vz3a1 first appeared in SCOP 1.69
- d1vz3a1 appears in SCOP 1.73
- d1vz3a1 appears in the current release, SCOPe 2.08
View in 3D
