| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins) N-terminal domain is a 7-bladed beta-propeller automatically mapped to Pfam PF00326 |
| Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [53498] (27 PDB entries) Uniprot P23687 |
| Domain d1vz2a2: 1vz2 A:431-710 [108946] Other proteins in same PDB: d1vz2a1 complexed with gol; mutant |
PDB Entry: 1vz2 (more details), 2.2 Å
SCOPe Domain Sequences for d1vz2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vz2a2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip
Timeline for d1vz2a2: