Lineage for d1vz2a1 (1vz2 A:1-430)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565803Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) (S)
  5. 565804Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein)
  6. 565805Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 565806Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries)
  8. 565821Domain d1vz2a1: 1vz2 A:1-430 [108945]
    Other proteins in same PDB: d1vz2a2
    complexed with gol; mutant

Details for d1vz2a1

PDB Entry: 1vz2 (more details), 2.2 Å

PDB Description: prolyl oligopeptidase from porcine brain, y73c/v427c/c255t mutant

SCOP Domain Sequences for d1vz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vz2a1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydcpkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregtdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtckgi

SCOP Domain Coordinates for d1vz2a1:

Click to download the PDB-style file with coordinates for d1vz2a1.
(The format of our PDB-style files is described here.)

Timeline for d1vz2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vz2a2