SCOPe 2.07: Domain d1vz0h1: 1vz0 H:116-208

Lineage for d1vz0h1 (1vz0 H:116-208)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

Superfamily a.4.14: KorB DNA-binding domain-like [109709] (2 families)

contains HTH motif in the common core; also contains extra N-terminal helix and C-terminal subdomain of 4 helices (left-handed superhelix)

Family a.4.14.1: KorB DNA-binding domain-like [109710] (2 proteins)
[N-terminal half of Pfam PF06613]
Protein Putative partitioning protein ParB/Spo0J [109713] (1 species)
Species Thermus thermophilus [TaxId:274] [109714] (1 PDB entry)
Uniprot Q9LCY0 # Fragment
Domain d1vz0h1: 1vz0 H:116-208 [108943]
Other proteins in same PDB: d1vz0a2, d1vz0b2, d1vz0c2, d1vz0d2, d1vz0e2, d1vz0f2, d1vz0g2, d1vz0h2
complexed with co, mg

Details for d1vz0h1

PDB Entry: 1vz0 (more details), 2.3 Å

PDB Description: chromosome segregation protein spo0j from thermus thermophilus

PDB Compounds: (H:) chromosome partitioning protein parb

SCOPe Domain Sequences for d1vz0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vz0h1 a.4.14.1 (H:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]}
edlspveeargyqallemgltqeevarrvgkarstvanalrllqlppealealergeita
gharallmlepedrlwglkeilekglsvrqaea

SCOPe Domain Coordinates for d1vz0h1:

Click to download the PDB-style file with coordinates for d1vz0h1.
(The format of our PDB-style files is described here.)

Timeline for d1vz0h1: