SCOPe 2.07: Domain d1vz0c2: 1vz0 C:23-115

Lineage for d1vz0c2 (1vz0 C:23-115)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
   beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)

4. Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families)

5. Family d.268.1.1: ParB-like nuclease domain [110850] (1 protein)
   Pfam PF02195

6. Protein Putative partitioning protein ParB/Spo0J [110851] (1 species)

7. Species Thermus thermophilus [TaxId:274] [110852] (1 PDB entry)
   Uniprot Q9LCY0 # Fragment

8. Domain d1vz0c2: 1vz0 C:23-115 [108934]
   Other proteins in same PDB: d1vz0a1, d1vz0b1, d1vz0c1, d1vz0d1, d1vz0e1, d1vz0f1, d1vz0g1, d1vz0h1
   complexed with co, mg

Details for d1vz0c2

PDB Entry: 1vz0, 2.3 Å

PDB Description: chromosome segregation protein spo0j from thermus thermophilus

PDB Compounds: (C:) chromosome partitioning protein parb

SCOPe Domain Sequences for d1vz0c2:

Sequence; same for both SEQRES and ATOM records:

>d1vz0c2 d.268.1.1 (C:23-115) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]}
vvrlplasirpnprqprkrfaeeslkeladsirekgllqpllvrpqgdgyelvagerryr
aalmaglqevpavvkdltdrealelalvenlqr

Timeline for d1vz0c2:

• d1vz0c2 first appeared in SCOP 1.69
  
• d1vz0c2 appears in SCOPe 2.06
  
• d1vz0c2 appears in the current release, SCOPe 2.08