SCOP 1.69: Domain d1vywd1: 1vyw D:178-309

Lineage for d1vywd1 (1vyw D:178-309)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries)

8. Domain d1vywd1: 1vyw D:178-309 [108926]
   Other proteins in same PDB: d1vywa_, d1vywc_

Details for d1vywd1

PDB Entry: 1vyw, 2.3 Å

PDB Description: structure of cdk2/cyclin a with pnu-292137

SCOP Domain Sequences for d1vywd1:

Sequence; same for both SEQRES and ATOM records:

>d1vywd1 a.74.1.1 (D:178-309) Cyclin A {Human (Homo sapiens)}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
vlkvltfdlaap

Timeline for d1vywd1:

• d1vywd1 is new in SCOP 1.69
  
• d1vywd1 appears in SCOP 1.71
  
• d1vywd1 appears in the current release, SCOPe 2.07