Lineage for d1vyva2 (1vyv A:216-402)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483826Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 483832Species Rat (Rattus norvegicus) [TaxId:10116] [110529] (3 PDB entries)
  8. 483837Domain d1vyva2: 1vyv A:216-402 [108919]
    Other proteins in same PDB: d1vyva1, d1vyvb1

Details for d1vyva2

PDB Entry: 1vyv (more details), 3 Å

PDB Description: beta4 subunit of ca2+ channel

SCOP Domain Sequences for d1vyva2:

Sequence, based on SEQRES records: (download)

>d1vyva2 c.37.1.1 (A:216-402) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadislakrsvlnnpsk
raiiersntksslaevqseierifelarslqlvvldadtinhpaqliktslapiivhvkv
sspkvlqrliksrgksqskhlnvqlvaadklaqcppemfdvildenqledacehlgeyle
aywrath

Sequence, based on observed residues (ATOM records): (download)

>d1vyva2 c.37.1.1 (A:216-402) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadislaksslaevqse
ierifelarslqlvvldadtinhpaqliktslapiivhvkvsspkvlqrliksrgksqsk
hlnvqlvaadklaqcppemfdvildenqledacehlgeyleaywrath

SCOP Domain Coordinates for d1vyva2:

Click to download the PDB-style file with coordinates for d1vyva2.
(The format of our PDB-style files is described here.)

Timeline for d1vyva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vyva1