Lineage for d1vyva1 (1vyv A:71-215)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2054065Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 2054066Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries)
    Uniprot P54287 38-362
  8. 2054073Domain d1vyva1: 1vyv A:71-215 [108918]
    Other proteins in same PDB: d1vyva2, d1vyvb2
    beta4 isoform with odd numbering

Details for d1vyva1

PDB Entry: 1vyv (more details), 3 Å

PDB Description: beta4 subunit of ca2+ channel
PDB Compounds: (A:) calcium channel beta-4subunit

SCOPe Domain Sequences for d1vyva1:

Sequence, based on SEQRES records: (download)

>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
airqereqqaaiqlerakskpvafavktnvsycgaldedvpvpssavsfdakdflhikek
ynndwwigrlvkegceigfipsplrleniriqqeqkrkrfhggkssgnsssslgemvsgt
fratptttakqkqkvtkhippydvv

Sequence, based on observed residues (ATOM records): (download)

>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
airqereqqaaiqlerakskpvafavktnvsycgaldedvpvpssavsfdakdflhikek
ynndwwigrlvkegceigfipsplrleniriqqeqkrkhippydvv

SCOPe Domain Coordinates for d1vyva1:

Click to download the PDB-style file with coordinates for d1vyva1.
(The format of our PDB-style files is described here.)

Timeline for d1vyva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vyva2