SCOP 1.69: Domain d1vyub2: 1vyu B:175-361

Lineage for d1vyub2 (1vyu B:175-361)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110529] (3 PDB entries)

8. Domain d1vyub2: 1vyu B:175-361 [108917]
   Other proteins in same PDB: d1vyua1, d1vyub1

Details for d1vyub2

PDB Entry: 1vyu, 2.3 Å

PDB Description: beta3 subunit of voltage-gated ca2+-channel

SCOP Domain Sequences for d1vyub2:

Sequence, based on SEQRES records:

>d1vyub2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgk
rtiierssarssiaevqseierifelakslqlvvldadtinhpaqlaktslapiivfvkv
sspkvlqrlirsrgksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeyle
vywrath

Sequence, based on observed residues (ATOM records):

>d1vyub2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakssiaevqse
ierifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmk
hltvqmmaydklvqcppesfdvildenqlddacehlaeylevywrath

Timeline for d1vyub2:

• d1vyub2 is new in SCOP 1.69
  
• d1vyub2 appears in SCOP 1.71
  
• d1vyub2 appears in the current release, SCOPe 2.08