![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [110529] (5 PDB entries) Uniprot P54287 38-362 |
![]() | Domain d1vyub2: 1vyu B:175-361 [108917] Other proteins in same PDB: d1vyua1, d1vyub1 |
PDB Entry: 1vyu (more details), 2.3 Å
SCOPe Domain Sequences for d1vyub2:
Sequence, based on SEQRES records: (download)
>d1vyub2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgk rtiierssarssiaevqseierifelakslqlvvldadtinhpaqlaktslapiivfvkv sspkvlqrlirsrgksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeyle vywrath
>d1vyub2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakssiaevqse ierifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmk hltvqmmaydklvqcppesfdvildenqlddacehlaeylevywrath
Timeline for d1vyub2: