Lineage for d1vyua2 (1vyu A:175-361)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829578Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 829584Species Rat (Rattus norvegicus) [TaxId:10116] [110529] (3 PDB entries)
    Uniprot P54287 38-362
  8. 829585Domain d1vyua2: 1vyu A:175-361 [108915]
    Other proteins in same PDB: d1vyua1, d1vyub1

Details for d1vyua2

PDB Entry: 1vyu (more details), 2.3 Å

PDB Description: beta3 subunit of voltage-gated ca2+-channel
PDB Compounds: (A:) calcium channel beta-3 subunit

SCOP Domain Sequences for d1vyua2:

Sequence, based on SEQRES records: (download)

>d1vyua2 c.37.1.1 (A:175-361) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgk
rtiierssarssiaevqseierifelakslqlvvldadtinhpaqlaktslapiivfvkv
sspkvlqrlirsrgksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeyle
vywrath

Sequence, based on observed residues (ATOM records): (download)

>d1vyua2 c.37.1.1 (A:175-361) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslaksiaevqsei
erifelakslqlvvldadtinhpaqlaktslapiivfvkvsspkvlqrlirsrgksqmkh
ltvqmmaydklvqcppesfdvildenqlddacehlaeylevywrath

SCOP Domain Coordinates for d1vyua2:

Click to download the PDB-style file with coordinates for d1vyua2.
(The format of our PDB-style files is described here.)

Timeline for d1vyua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vyua1