SCOP 1.69: Domain d1vyua1: 1vyu A:39-174

Lineage for d1vyua1 (1vyu A:39-174)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (35 proteins)

6. Protein SH3-like domain of the L-type calcium channel [110158] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110160] (3 PDB entries)

8. Domain d1vyua1: 1vyu A:39-174 [108914]
   Other proteins in same PDB: d1vyua2, d1vyub2

Details for d1vyua1

PDB Entry: 1vyu, 2.3 Å

PDB Description: beta3 subunit of voltage-gated ca2+-channel

SCOP Domain Sequences for d1vyua1:

Sequence, based on SEQRES records:

>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek
ysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsla
kqkqkqaehvppydvv

Sequence, based on observed residues (ATOM records):

>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek
ysndwwigrlvkeggdiafipspqrlesirlkqeqkvppydvv

Timeline for d1vyua1:

• d1vyua1 is new in SCOP 1.69
  
• d1vyua1 appears in SCOP 1.71
  
• d1vyua1 appears in the current release, SCOPe 2.08