![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries) Uniprot P54287 38-362 |
![]() | Domain d1vyua1: 1vyu A:39-174 [108914] Other proteins in same PDB: d1vyua2, d1vyub2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1vyu (more details), 2.3 Å
SCOPe Domain Sequences for d1vyua1:
Sequence, based on SEQRES records: (download)
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek ysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsla kqkqkqaehvppydvv
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek ysndwwigrlvkeggdiafipspqrlesirlkqeqkvppydvv
Timeline for d1vyua1: