Lineage for d1vyua1 (1vyu A:39-174)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783224Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 2783225Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries)
    Uniprot P54287 38-362
  8. 2783228Domain d1vyua1: 1vyu A:39-174 [108914]
    Other proteins in same PDB: d1vyua2, d1vyub2
    has additional insertions and/or extensions that are not grouped together

Details for d1vyua1

PDB Entry: 1vyu (more details), 2.3 Å

PDB Description: beta3 subunit of voltage-gated ca2+-channel
PDB Compounds: (A:) calcium channel beta-3 subunit

SCOPe Domain Sequences for d1vyua1:

Sequence, based on SEQRES records: (download)

>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek
ysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsla
kqkqkqaehvppydvv

Sequence, based on observed residues (ATOM records): (download)

>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhikek
ysndwwigrlvkeggdiafipspqrlesirlkqeqkvppydvv

SCOPe Domain Coordinates for d1vyua1:

Click to download the PDB-style file with coordinates for d1vyua1.
(The format of our PDB-style files is described here.)

Timeline for d1vyua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vyua2