SCOPe 2.05: Domain d1vytb2: 1vyt B:175-361

Lineage for d1vytb2 (1vyt B:175-361)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110529] (5 PDB entries)
   Uniprot P54287 38-362

8. Domain d1vytb2: 1vyt B:175-361 [108911]
   Other proteins in same PDB: d1vyta1, d1vytb1, d1vyte_, d1vytf_

Details for d1vytb2

PDB Entry: 1vyt, 2.6 Å

PDB Description: beta3 subunit complexed with aid

PDB Compounds: (B:) calcium channel beta-3 subunit

SCOPe Domain Sequences for d1vytb2:

Sequence; same for both SEQRES and ATOM records:

>d1vytb2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgk
rtiierssarssiaevqseierifelakslqlvvldadtinhpaqlaktslapiivfvkv
sspkvlqrlirsrgksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeyle
vywrath

Timeline for d1vytb2:

• d1vytb2 first appeared in SCOP 1.69
  
• d1vytb2 appears in SCOPe 2.04
  
• d1vytb2 appears in SCOPe 2.06
  
• d1vytb2 appears in the current release, SCOPe 2.08