Lineage for d1vytb2 (1vyt B:175-361)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483826Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 483832Species Rat (Rattus norvegicus) [TaxId:10116] [110529] (3 PDB entries)
  8. 483836Domain d1vytb2: 1vyt B:175-361 [108911]
    Other proteins in same PDB: d1vyta1, d1vytb1, d1vyte_, d1vytf_

Details for d1vytb2

PDB Entry: 1vyt (more details), 2.6 Å

PDB Description: beta3 subunit complexed with aid

SCOP Domain Sequences for d1vytb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vytb2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgk
rtiierssarssiaevqseierifelakslqlvvldadtinhpaqlaktslapiivfvkv
sspkvlqrlirsrgksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeyle
vywrath

SCOP Domain Coordinates for d1vytb2:

Click to download the PDB-style file with coordinates for d1vytb2.
(The format of our PDB-style files is described here.)

Timeline for d1vytb2: