![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [110529] (3 PDB entries) |
![]() | Domain d1vytb2: 1vyt B:175-361 [108911] Other proteins in same PDB: d1vyta1, d1vytb1, d1vyte_, d1vytf_ |
PDB Entry: 1vyt (more details), 2.6 Å
SCOP Domain Sequences for d1vytb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vytb2 c.37.1.1 (B:175-361) Guanylate kinase-like domain of the L-type calcium channel {Rat (Rattus norvegicus)} psmrpvvlvgpslkgyevtdmmqkalfdflkhrfdgrisitrvtadlslakrsvlnnpgk rtiierssarssiaevqseierifelakslqlvvldadtinhpaqlaktslapiivfvkv sspkvlqrlirsrgksqmkhltvqmmaydklvqcppesfdvildenqlddacehlaeyle vywrath
Timeline for d1vytb2:
![]() Domains from other chains: (mouse over for more information) d1vyta1, d1vyta2, d1vyte_, d1vytf_ |