Lineage for d1vytb1 (1vyt B:38-174)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392839Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 2392840Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries)
    Uniprot P54287 38-362
  8. 2392846Domain d1vytb1: 1vyt B:38-174 [108910]
    Other proteins in same PDB: d1vyta2, d1vytb2, d1vyte_, d1vytf_

Details for d1vytb1

PDB Entry: 1vyt (more details), 2.6 Å

PDB Description: beta3 subunit complexed with aid
PDB Compounds: (B:) calcium channel beta-3 subunit

SCOPe Domain Sequences for d1vytb1:

Sequence, based on SEQRES records: (download)

>d1vytb1 b.34.2.1 (B:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsl
akqkqkqaehvppydvv

Sequence, based on observed residues (ATOM records): (download)

>d1vytb1 b.34.2.1 (B:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkahvppydvv

SCOPe Domain Coordinates for d1vytb1:

Click to download the PDB-style file with coordinates for d1vytb1.
(The format of our PDB-style files is described here.)

Timeline for d1vytb1: