Lineage for d1vytb1 (1vyt B:38-174)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461236Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 461237Family b.34.2.1: SH3-domain [50045] (35 proteins)
  6. 461485Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 461491Species Rat (Rattus norvegicus) [TaxId:10116] [110160] (3 PDB entries)
  8. 461495Domain d1vytb1: 1vyt B:38-174 [108910]
    Other proteins in same PDB: d1vyta2, d1vytb2, d1vyte_, d1vytf_

Details for d1vytb1

PDB Entry: 1vyt (more details), 2.6 Å

PDB Description: beta3 subunit complexed with aid

SCOP Domain Sequences for d1vytb1:

Sequence, based on SEQRES records: (download)

>d1vytb1 b.34.2.1 (B:38-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsl
akqkqkqaehvppydvv

Sequence, based on observed residues (ATOM records): (download)

>d1vytb1 b.34.2.1 (B:38-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus)}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkahvppydvv

SCOP Domain Coordinates for d1vytb1:

Click to download the PDB-style file with coordinates for d1vytb1.
(The format of our PDB-style files is described here.)

Timeline for d1vytb1: