Lineage for d1vyta1 (1vyt A:38-174)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046122Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 2046123Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries)
    Uniprot P54287 38-362
  8. 2046128Domain d1vyta1: 1vyt A:38-174 [108908]
    Other proteins in same PDB: d1vyta2, d1vytb2, d1vyte_, d1vytf_

Details for d1vyta1

PDB Entry: 1vyt (more details), 2.6 Å

PDB Description: beta3 subunit complexed with aid
PDB Compounds: (A:) calcium channel beta-3 subunit

SCOPe Domain Sequences for d1vyta1:

Sequence, based on SEQRES records: (download)

>d1vyta1 b.34.2.1 (A:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsl
akqkqkqaehvppydvv

Sequence, based on observed residues (ATOM records): (download)

>d1vyta1 b.34.2.1 (A:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkarhvppydvv

SCOPe Domain Coordinates for d1vyta1:

Click to download the PDB-style file with coordinates for d1vyta1.
(The format of our PDB-style files is described here.)

Timeline for d1vyta1: