![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries) Uniprot P54287 38-362 |
![]() | Domain d1vyta1: 1vyt A:38-174 [108908] Other proteins in same PDB: d1vyta2, d1vytb2, d1vyte_, d1vytf_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1vyt (more details), 2.6 Å
SCOPe Domain Sequences for d1vyta1:
Sequence, based on SEQRES records: (download)
>d1vyta1 b.34.2.1 (A:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike kysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsl akqkqkqaehvppydvv
>d1vyta1 b.34.2.1 (A:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike kysndwwigrlvkeggdiafipspqrlesirlkqeqkarhvppydvv
Timeline for d1vyta1:
![]() Domains from other chains: (mouse over for more information) d1vytb1, d1vytb2, d1vyte_, d1vytf_ |